![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.2: C2HC finger [57697] (3 proteins) |
![]() | Protein Cell growth regulating nucleolar protein LyaR [118271] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118272] (1 PDB entry) Uniprot Q08288 1-66 |
![]() | Domain d1wjva2: 1wjv A:36-66 [114714] Other proteins in same PDB: d1wjva3, d1wjva4 Structural genomics target complexed with zn |
PDB Entry: 1wjv (more details)
SCOPe Domain Sequences for d1wjva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjva2 g.37.1.2 (A:36-66) Cell growth regulating nucleolar protein LyaR {Mouse (Mus musculus) [TaxId: 10090]} eclscidcgkdfwgddykshvkcisegqkyg
Timeline for d1wjva2: