Lineage for d1wjva2 (1wjv A:36-66)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749946Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 749947Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) (S)
  5. 750165Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 750166Protein Cell growth regulating nucleolar protein LyaR [118271] (1 species)
  7. 750167Species Mouse (Mus musculus) [TaxId:10090] [118272] (1 PDB entry)
  8. 750169Domain d1wjva2: 1wjv A:36-66 [114714]
    Structural genomics target
    complexed with zn

Details for d1wjva2

PDB Entry: 1wjv (more details)

PDB Description: solution structure of the n-terminal zinc finger domain of mouse cell growth regulating nucleolar protein lyar
PDB Compounds: (A:) Cell growth regulating nucleolar protein LYAR

SCOP Domain Sequences for d1wjva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjva2 g.37.1.2 (A:36-66) Cell growth regulating nucleolar protein LyaR {Mouse (Mus musculus) [TaxId: 10090]}
eclscidcgkdfwgddykshvkcisegqkyg

SCOP Domain Coordinates for d1wjva2:

Click to download the PDB-style file with coordinates for d1wjva2.
(The format of our PDB-style files is described here.)

Timeline for d1wjva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wjva1