Lineage for d1wjva2 (1wjv A:36-66)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035480Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 3035481Protein Cell growth regulating nucleolar protein LyaR [118271] (1 species)
  7. 3035482Species Mouse (Mus musculus) [TaxId:10090] [118272] (1 PDB entry)
    Uniprot Q08288 1-66
  8. 3035484Domain d1wjva2: 1wjv A:36-66 [114714]
    Other proteins in same PDB: d1wjva3, d1wjva4
    Structural genomics target
    complexed with zn

Details for d1wjva2

PDB Entry: 1wjv (more details)

PDB Description: solution structure of the n-terminal zinc finger domain of mouse cell growth regulating nucleolar protein lyar
PDB Compounds: (A:) Cell growth regulating nucleolar protein LYAR

SCOPe Domain Sequences for d1wjva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjva2 g.37.1.2 (A:36-66) Cell growth regulating nucleolar protein LyaR {Mouse (Mus musculus) [TaxId: 10090]}
eclscidcgkdfwgddykshvkcisegqkyg

SCOPe Domain Coordinates for d1wjva2:

Click to download the PDB-style file with coordinates for d1wjva2.
(The format of our PDB-style files is described here.)

Timeline for d1wjva2: