Lineage for d1wjva1 (1wjv A:1-35)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624085Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 624086Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (5 families) (S)
  5. 624245Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 624246Protein Cell growth regulating nucleolar protein LyaR [118271] (1 species)
  7. 624247Species Mouse (Mus musculus) [TaxId:10090] [118272] (1 PDB entry)
  8. 624248Domain d1wjva1: 1wjv A:1-35 [114713]

Details for d1wjva1

PDB Entry: 1wjv (more details)

PDB Description: solution structure of the n-terminal zinc finger domain of mouse cell growth regulating nucleolar protein lyar

SCOP Domain Sequences for d1wjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjva1 g.37.1.2 (A:1-35) Cell growth regulating nucleolar protein LyaR {Mouse (Mus musculus)}
gssgssgmvfftcnacgesvkkiqvekhvsncrnc

SCOP Domain Coordinates for d1wjva1:

Click to download the PDB-style file with coordinates for d1wjva1.
(The format of our PDB-style files is described here.)

Timeline for d1wjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wjva2