SCOPe 2.07: Domain d1wjua1: 1wju A:8-94

Lineage for d1wjua1 (1wju A:8-94)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein NEDD8 ultimate buster-1, NUB1 [117814] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117815] (1 PDB entry)
   Uniprot Q9Y5A7 75-161

8. Domain d1wjua1: 1wju A:8-94 [114712]
   Other proteins in same PDB: d1wjua2, d1wjua3
   Structural genomics target

Details for d1wjua1

PDB Entry: 1wju

PDB Description: solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1

PDB Compounds: (A:) NEDD8 ultimate buster-1

SCOPe Domain Sequences for d1wjua1:

Sequence; same for both SEQRES and ATOM records:

>d1wjua1 d.15.1.1 (A:8-94) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]}
dnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyikivinkk
qlqlgktleeqgvahnvkamvlelkqs

Timeline for d1wjua1:

• d1wjua1 first appeared in SCOP 1.71, called d1wjua_
  
• d1wjua1 appears in SCOPe 2.06
  
• d1wjua1 appears in the current release, SCOPe 2.08