Lineage for d1wjua_ (1wju A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892726Protein NEDD8 ultimate buster-1, NUB1 [117814] (1 species)
  7. 1892727Species Human (Homo sapiens) [TaxId:9606] [117815] (1 PDB entry)
    Uniprot Q9Y5A7 75-161
  8. 1892728Domain d1wjua_: 1wju A: [114712]
    Structural genomics target

Details for d1wjua_

PDB Entry: 1wju (more details)

PDB Description: Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
PDB Compounds: (A:) NEDD8 ultimate buster-1

SCOPe Domain Sequences for d1wjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyi
kivinkkqlqlgktleeqgvahnvkamvlelkqssgpssg

SCOPe Domain Coordinates for d1wjua_:

Click to download the PDB-style file with coordinates for d1wjua_.
(The format of our PDB-style files is described here.)

Timeline for d1wjua_: