Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein NEDD8 ultimate buster-1, NUB1 [117814] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117815] (1 PDB entry) |
Domain d1wjua_: 1wju A: [114712] Structural genomics target |
PDB Entry: 1wju (more details)
SCOP Domain Sequences for d1wjua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} gssgssgdnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyi kivinkkqlqlgktleeqgvahnvkamvlelkqssgpssg
Timeline for d1wjua_: