Lineage for d1wjua_ (1wju A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717154Protein NEDD8 ultimate buster-1, NUB1 [117814] (1 species)
  7. 717155Species Human (Homo sapiens) [TaxId:9606] [117815] (1 PDB entry)
  8. 717156Domain d1wjua_: 1wju A: [114712]
    Structural genomics target

Details for d1wjua_

PDB Entry: 1wju (more details)

PDB Description: solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1
PDB Compounds: (A:) NEDD8 ultimate buster-1

SCOP Domain Sequences for d1wjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyi
kivinkkqlqlgktleeqgvahnvkamvlelkqssgpssg

SCOP Domain Coordinates for d1wjua_:

Click to download the PDB-style file with coordinates for d1wjua_.
(The format of our PDB-style files is described here.)

Timeline for d1wjua_: