Lineage for d1wjua_ (1wju A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598490Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
    Pfam 00240
  6. 598532Protein NEDD8 ultimate buster-1, NUB1 [117814] (1 species)
  7. 598533Species Human (Homo sapiens) [TaxId:9606] [117815] (1 PDB entry)
  8. 598534Domain d1wjua_: 1wju A: [114712]
    Structural genomics target

Details for d1wjua_

PDB Entry: 1wju (more details)

PDB Description: solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1

SCOP Domain Sequences for d1wjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens)}
gssgssgdnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyi
kivinkkqlqlgktleeqgvahnvkamvlelkqssgpssg

SCOP Domain Coordinates for d1wjua_:

Click to download the PDB-style file with coordinates for d1wjua_.
(The format of our PDB-style files is described here.)

Timeline for d1wjua_: