Lineage for d1wjua1 (1wju A:8-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931457Protein NEDD8 ultimate buster-1, NUB1 [117814] (1 species)
  7. 2931458Species Human (Homo sapiens) [TaxId:9606] [117815] (1 PDB entry)
    Uniprot Q9Y5A7 75-161
  8. 2931459Domain d1wjua1: 1wju A:8-94 [114712]
    Other proteins in same PDB: d1wjua2, d1wjua3
    Structural genomics target

Details for d1wjua1

PDB Entry: 1wju (more details)

PDB Description: solution structure of n-terminal ubiquitin-like domain of human nedd8 ultimate buster-1
PDB Compounds: (A:) NEDD8 ultimate buster-1

SCOPe Domain Sequences for d1wjua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjua1 d.15.1.1 (A:8-94) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]}
dnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyikivinkk
qlqlgktleeqgvahnvkamvlelkqs

SCOPe Domain Coordinates for d1wjua1:

Click to download the PDB-style file with coordinates for d1wjua1.
(The format of our PDB-style files is described here.)

Timeline for d1wjua1: