Lineage for d1wjqa_ (1wjq A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557875Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 557918Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam 02820
    contains extended 'arm', N-terminal to the common fold core
  6. 557919Protein Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) [117153] (1 species)
  7. 557920Species Human (Homo sapiens) [TaxId:9606] [117154] (2 PDB entries)
  8. 557921Domain d1wjqa_: 1wjq A: [114708]
    Structural genomics target; 3rd MBT repeat

Details for d1wjqa_

PDB Entry: 1wjq (more details)

PDB Description: solution structure of the third mbt domain from human kiaa1798 protein

SCOP Domain Sequences for d1wjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens)}
gssgssgvkpphgfqkkmklevvdkrnpmfirvatvadtddhrvkvhfdgwnncydywid
adspdihpvgwcsktghplqpplsplelmeasehggcstpgsgpssg

SCOP Domain Coordinates for d1wjqa_:

Click to download the PDB-style file with coordinates for d1wjqa_.
(The format of our PDB-style files is described here.)

Timeline for d1wjqa_: