Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
Protein Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) [117153] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117154] (2 PDB entries) Uniprot Q96JM7 259-372, 469-562 |
Domain d1wjqa1: 1wjq A:8-101 [114708] Other proteins in same PDB: d1wjqa2, d1wjqa3 Structural genomics target; 3rd MBT repeat missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1wjq (more details)
SCOPe Domain Sequences for d1wjqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjqa1 b.34.9.3 (A:8-101) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} vkpphgfqkkmklevvdkrnpmfirvatvadtddhrvkvhfdgwnncydywidadspdih pvgwcsktghplqpplsplelmeasehggcstpg
Timeline for d1wjqa1: