Lineage for d1wjpa1 (1wjp A:1-42)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749946Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 749947Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) (S)
  5. 749948Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 750128Protein Zinc finger protein 295, ZNF295 [118267] (1 species)
  7. 750129Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry)
  8. 750130Domain d1wjpa1: 1wjp A:1-42 [114705]

Details for d1wjpa1

PDB Entry: 1wjp (more details)

PDB Description: solution structure of zf-c2h2 domains from human zinc finger protein 295
PDB Compounds: (A:) Zinc finger protein 295

SCOP Domain Sequences for d1wjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjpa1 g.37.1.1 (A:1-42) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgaspvenkevyqcrlcnaklsslleqgsherlcrna

SCOP Domain Coordinates for d1wjpa1:

Click to download the PDB-style file with coordinates for d1wjpa1.
(The format of our PDB-style files is described here.)

Timeline for d1wjpa1: