Lineage for d1wjoa1 (1wjo A:8-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712052Protein Fimbrin (Plastin), actin-crosslinking domain [47580] (3 species)
    duplication: tandem repeat of four CH domains
  7. 2712055Species Human (Homo sapiens) [TaxId:9606] [47581] (2 PDB entries)
    Uniprot P13797 121-375, 517-627
  8. 2712058Domain d1wjoa1: 1wjo A:8-118 [114704]
    Other proteins in same PDB: d1wjoa2, d1wjoa3
    Structural genomics target; 4th CH domain

Details for d1wjoa1

PDB Entry: 1wjo (more details)

PDB Description: solution structure of the forth ch domain from human plastin 3 t- isoform
PDB Compounds: (A:) T-plastin

SCOPe Domain Sequences for d1wjoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjoa1 a.40.1.1 (A:8-118) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]}
nddiivnwvnrtlseagkstsiqsfkdktissslavvdlidaiqpgcinydlvksgnlte
ddkhnnakyavsmarrigarvyalpedlvevkpkmvmtvfaclmgrgmkrv

SCOPe Domain Coordinates for d1wjoa1:

Click to download the PDB-style file with coordinates for d1wjoa1.
(The format of our PDB-style files is described here.)

Timeline for d1wjoa1: