Lineage for d1wjma1 (1wjm A:8-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2070982Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2070994Protein beta-spectrin [50733] (3 species)
  7. 2070997Species Human (Homo sapiens), brain 2 isoform [TaxId:9606] [117243] (1 PDB entry)
    Uniprot O15020 2219-2324
  8. 2070998Domain d1wjma1: 1wjm A:8-117 [114702]
    Other proteins in same PDB: d1wjma2, d1wjma3
    Structural genomics target

Details for d1wjma1

PDB Entry: 1wjm (more details)

PDB Description: solution structure of pleckstrin homology domain of human beta iii spectrin.
PDB Compounds: (A:) beta-spectrin III

SCOPe Domain Sequences for d1wjma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjma1 b.55.1.1 (A:8-117) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]}
eqmegmlcrkqemeafgkkaanrswqnvycvlrrgslgfykdakaasagvpyhgevpvsl
araqgsvafdyrkrkhvfklglqdgkeylfqakdeaemsswlrvvnaaia

SCOPe Domain Coordinates for d1wjma1:

Click to download the PDB-style file with coordinates for d1wjma1.
(The format of our PDB-style files is described here.)

Timeline for d1wjma1: