Lineage for d1wjma_ (1wjm A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563852Protein beta-spectrin [50733] (3 species)
  7. 563855Species Human (Homo sapiens), brain 2 isoform [TaxId:9606] [117243] (1 PDB entry)
  8. 563856Domain d1wjma_: 1wjm A: [114702]
    Structural genomics target

Details for d1wjma_

PDB Entry: 1wjm (more details)

PDB Description: solution structure of pleckstrin homology domain of human beta iii spectrin.

SCOP Domain Sequences for d1wjma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform}
gssgssgeqmegmlcrkqemeafgkkaanrswqnvycvlrrgslgfykdakaasagvpyh
gevpvslaraqgsvafdyrkrkhvfklglqdgkeylfqakdeaemsswlrvvnaaiasgp
ssg

SCOP Domain Coordinates for d1wjma_:

Click to download the PDB-style file with coordinates for d1wjma_.
(The format of our PDB-style files is described here.)

Timeline for d1wjma_: