SCOP 1.71: Domain d1wjla_: 1wjl A:

Lineage for d1wjla_ (1wjl A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (35 proteins)
   Pfam 00595

6. Protein Zasp (Cypher, Oracle 1) [101735] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117173] (1 PDB entry)

8. Domain d1wjla_: 1wjl A: [114701]
   Structural genomics target; fragment

Details for d1wjla_

PDB Entry: 1wjl

PDB Description: solution structure of pdz domain of mouse cypher protein

SCOP Domain Sequences for d1wjla_:

Sequence; same for both SEQRES and ATOM records:

>d1wjla_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Mouse (Mus musculus)}
gssgssgmsysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaid
gvntdtmthleaqnkiksasynlsltlqks

Timeline for d1wjla_:

• d1wjla_ is new in SCOP 1.71
  
• d1wjla_ appears in SCOP 1.73
  
• d1wjla_ appears in the current release, SCOPe 2.08, called d1wjla1