Lineage for d1wjla1 (1wjl A:8-90)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786229Protein Zasp (Cypher, Oracle 1) [101735] (2 species)
  7. 2786232Species Mouse (Mus musculus) [TaxId:10090] [117173] (1 PDB entry)
    Uniprot Q9D130 1-83
  8. 2786233Domain d1wjla1: 1wjl A:8-90 [114701]
    Other proteins in same PDB: d1wjla2
    Structural genomics target; fragment

Details for d1wjla1

PDB Entry: 1wjl (more details)

PDB Description: solution structure of pdz domain of mouse cypher protein
PDB Compounds: (A:) Cypher protein

SCOPe Domain Sequences for d1wjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjla1 b.36.1.1 (A:8-90) Zasp (Cypher, Oracle 1) {Mouse (Mus musculus) [TaxId: 10090]}
msysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaidgvntdtm
thleaqnkiksasynlsltlqks

SCOPe Domain Coordinates for d1wjla1:

Click to download the PDB-style file with coordinates for d1wjla1.
(The format of our PDB-style files is described here.)

Timeline for d1wjla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wjla2