SCOP 1.75: Domain d1wjka_: 1wjk A:

Lineage for d1wjka_ (1wjk A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin-like structure containing protein C330018D20Rik [117593] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117594] (1 PDB entry)
   Uniprot Q9CWB7 21-107

8. Domain d1wjka_: 1wjk A: [114700]
   Structural genomics target

Details for d1wjka_

PDB Entry: 1wjk

PDB Description: solution structure of hypothetical protein c330018d20rik from mus musculus

PDB Compounds: (A:) C330018D20rik protein

SCOP Domain Sequences for d1wjka_:

Sequence; same for both SEQRES and ATOM records:

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgnlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwy
erykfdipvfhlngqflmmhrvntsklekqlrklsgpssg

Timeline for d1wjka_:

• d1wjka_ first appeared in SCOP 1.71
  
• d1wjka_ appears in SCOP 1.73
  
• d1wjka_ appears in SCOPe 2.01
  
• d1wjka_ appears in the current release, SCOPe 2.08, called d1wjka1