Lineage for d1wjja1 (1wjj A:8-139)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789367Protein Hypothetical protein At4g28440 (F20O9.120) [117193] (1 species)
  7. 2789368Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117194] (1 PDB entry)
    Uniprot O49453 14-145
  8. 2789369Domain d1wjja1: 1wjj A:8-139 [114699]
    Other proteins in same PDB: d1wjja2, d1wjja3
    Structural genomics target

Details for d1wjja1

PDB Entry: 1wjj (more details)

PDB Description: solution structure of hypothetical protein f20o9.120 from arabidopsis thaliana
PDB Compounds: (A:) hypothetical protein F20O9.120

SCOPe Domain Sequences for d1wjja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjja1 b.40.4.3 (A:8-139) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stvkrkpvfvkveqlkpgttghtltvkvieanivvpvtrktrpasslsrpsqpsrivecl
igdetgcilftarndqvdlmkpgatvilrnsridmfkgtmrlgvdkwgrieatgaasftv
kednnlslveye

SCOPe Domain Coordinates for d1wjja1:

Click to download the PDB-style file with coordinates for d1wjja1.
(The format of our PDB-style files is described here.)

Timeline for d1wjja1: