Lineage for d1wjia_ (1wji A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1260917Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1260941Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 1260942Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1261009Protein Tudor domain containing protein 3, TDRD3 [116834] (1 species)
  7. 1261010Species Human (Homo sapiens) [TaxId:9606] [116835] (1 PDB entry)
    Uniprot Q9H7E2 194-243
  8. 1261011Domain d1wjia_: 1wji A: [114698]
    Structural genomics target

Details for d1wjia_

PDB Entry: 1wji (more details)

PDB Description: Solution Structure of the UBA Domain of Human Tudor Domain Containing Protein 3
PDB Compounds: (A:) Tudor domain containing protein 3

SCOPe Domain Sequences for d1wjia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgvdekalkhitemgfskeasrqalmdngnnleaalnvlltsnkqkpvmgppsgp
ssg

SCOPe Domain Coordinates for d1wjia_:

Click to download the PDB-style file with coordinates for d1wjia_.
(The format of our PDB-style files is described here.)

Timeline for d1wjia_: