SCOP 1.73: Domain d1wjia_: 1wji A:

Lineage for d1wjia_ (1wji A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (22 proteins)

6. Protein Tudor domain containing protein 3, TDRD3 [116834] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116835] (1 PDB entry)

8. Domain d1wjia_: 1wji A: [114698]
   Structural genomics target

Details for d1wjia_

PDB Entry: 1wji

PDB Description: solution structure of the uba domain of human tudor domain containing protein 3

PDB Compounds: (A:) Tudor domain containing protein 3

SCOP Domain Sequences for d1wjia_:

Sequence; same for both SEQRES and ATOM records:

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgvdekalkhitemgfskeasrqalmdngnnleaalnvlltsnkqkpvmgppsgp
ssg

Timeline for d1wjia_:

• d1wjia_ first appeared in SCOP 1.71
  
• d1wjia_ appears in SCOP 1.75
  
• d1wjia_ appears in the current release, SCOPe 2.08, called d1wjia1