Lineage for d1wjia1 (1wji A:8-57)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984811Protein Tudor domain containing protein 3, TDRD3 [116834] (1 species)
  7. 1984812Species Human (Homo sapiens) [TaxId:9606] [116835] (1 PDB entry)
    Uniprot Q9H7E2 194-243
  8. 1984813Domain d1wjia1: 1wji A:8-57 [114698]
    Other proteins in same PDB: d1wjia2, d1wjia3
    Structural genomics target

Details for d1wjia1

PDB Entry: 1wji (more details)

PDB Description: Solution Structure of the UBA Domain of Human Tudor Domain Containing Protein 3
PDB Compounds: (A:) Tudor domain containing protein 3

SCOPe Domain Sequences for d1wjia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjia1 a.5.2.1 (A:8-57) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
vdekalkhitemgfskeasrqalmdngnnleaalnvlltsnkqkpvmgpp

SCOPe Domain Coordinates for d1wjia1:

Click to download the PDB-style file with coordinates for d1wjia1.
(The format of our PDB-style files is described here.)

Timeline for d1wjia1: