SCOPe 2.08: Domain d1wjia1: 1wji A:8-57

Lineage for d1wjia1 (1wji A:8-57)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Tudor domain containing protein 3, TDRD3 [116834] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116835] (1 PDB entry)
   Uniprot Q9H7E2 194-243

8. Domain d1wjia1: 1wji A:8-57 [114698]
   Other proteins in same PDB: d1wjia2, d1wjia3
   Structural genomics target

Details for d1wjia1

PDB Entry: 1wji

PDB Description: solution structure of the uba domain of human tudor domain containing protein 3

PDB Compounds: (A:) Tudor domain containing protein 3

SCOPe Domain Sequences for d1wjia1:

Sequence; same for both SEQRES and ATOM records:

>d1wjia1 a.5.2.1 (A:8-57) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
vdekalkhitemgfskeasrqalmdngnnleaalnvlltsnkqkpvmgpp

Timeline for d1wjia1:

• d1wjia1 first appeared in SCOP 1.71, called d1wjia_
  
• d1wjia1 appears in SCOPe 2.07