SCOP 1.71: Domain d1wj9a1: 1wj9 A:1-87

Lineage for d1wj9a1 (1wj9 A:1-87)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.53: CRISPR-associated protein [117987] (1 family)
   duplication: contains two subdomains of this fold

5. Family d.58.53.1: CRISPR-associated protein [117988] (1 protein)

6. Protein Hypothetical protein TTHB192 [117989] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)

8. Domain d1wj9a1: 1wj9 A:1-87 [114694]

Details for d1wj9a1

PDB Entry: 1wj9, 1.9 Å

PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus

SCOP Domain Sequences for d1wj9a1:

Sequence; same for both SEQRES and ATOM records:

>d1wj9a1 d.58.53.1 (A:1-87) Hypothetical protein TTHB192 {Thermus thermophilus}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp

Timeline for d1wj9a1:

• d1wj9a1 is new in SCOP 1.71
  
• d1wj9a1 appears in SCOP 1.73
  
• d1wj9a1 appears in the current release, SCOPe 2.08