SCOPe 2.08: Domain d1wj9a1: 1wj9 A:1-87

Lineage for d1wj9a1 (1wj9 A:1-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families)

5. Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins)
   duplication: contains two subdomains of this fold

6. Protein CRISPR-associated endoribonuclease Cse3 [117989] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)
   Uniprot Q53WG9

8. Domain d1wj9a1: 1wj9 A:1-87 [114694]
   Structural genomics target

Details for d1wj9a1

PDB Entry: 1wj9, 1.9 Å

PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus

PDB Compounds: (A:) CRISPR-associated protein

SCOPe Domain Sequences for d1wj9a1:

Sequence; same for both SEQRES and ATOM records:

>d1wj9a1 d.58.53.1 (A:1-87) CRISPR-associated endoribonuclease Cse3 {Thermus thermophilus [TaxId: 274]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp

Timeline for d1wj9a1:

• d1wj9a1 first appeared in SCOP 1.71
  
• d1wj9a1 appears in SCOPe 2.07