Lineage for d1wj6a1 (1wj6 A:8-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933661Protein Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) [117829] (1 species)
  7. 2933662Species Human (Homo sapiens) [TaxId:9606] [117830] (2 PDB entries)
    Uniprot Q14596 1-85
  8. 2933664Domain d1wj6a1: 1wj6 A:8-95 [114693]
    Other proteins in same PDB: d1wj6a2, d1wj6a3
    Structural genomics target

Details for d1wj6a1

PDB Entry: 1wj6 (more details)

PDB Description: solution structure of rsgi ruh-024, a pb1 domain in human cdna, kiaa0049
PDB Compounds: (A:) KIAA0049 protein

SCOPe Domain Sequences for d1wj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj6a1 d.15.2.2 (A:8-95) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]}
phsmepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevs
insqgeyeealkmavkqgnqlqmqvheg

SCOPe Domain Coordinates for d1wj6a1:

Click to download the PDB-style file with coordinates for d1wj6a1.
(The format of our PDB-style files is described here.)

Timeline for d1wj6a1: