SCOP 1.71: Domain d1wj5a_: 1wj5 A:

Lineage for d1wj5a_ (1wj5 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.59: An Obfc1 domain [116801] (1 protein)
   helix-loop insertion in the HTH motif

6. Protein OB fold-containing protein 1, Obfc1 [116802] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116803] (1 PDB entry)

8. Domain d1wj5a_: 1wj5 A: [114692]
   Structural genomics target

Details for d1wj5a_

PDB Entry: 1wj5

PDB Description: solution structure of the hypothetical domain of riken cdna 0610009h20

SCOP Domain Sequences for d1wj5a_:

Sequence; same for both SEQRES and ATOM records:

>d1wj5a_ a.4.5.59 (A:) OB fold-containing protein 1, Obfc1 {Mouse (Mus musculus)}
gssgssgnkdnldlagltsllsekikeflqekkmqsfyqqeletveslqslasrpvthst
gsdqvelkdsgtsgvaqrvfknalqllqekglvfqrdsgsdklyyvttkdkdlqsgpssg

Timeline for d1wj5a_:

• d1wj5a_ is new in SCOP 1.71
  
• d1wj5a_ appears in SCOP 1.73
  
• d1wj5a_ appears in the current release, SCOPe 2.08, called d1wj5a1