Lineage for d1wj5a_ (1wj5 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533942Family a.4.5.59: An Obfc1 domain [116801] (1 protein)
    helix-loop insertion in the HTH motif
  6. 533943Protein OB fold-containing protein 1, Obfc1 [116802] (1 species)
  7. 533944Species Mouse (Mus musculus) [TaxId:10090] [116803] (1 PDB entry)
  8. 533945Domain d1wj5a_: 1wj5 A: [114692]
    Structural genomics target

Details for d1wj5a_

PDB Entry: 1wj5 (more details)

PDB Description: Solution structure of the hypothetical domain of RIKEN cDNA 0610009H20

SCOP Domain Sequences for d1wj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj5a_ a.4.5.59 (A:) OB fold-containing protein 1, Obfc1 {Mouse (Mus musculus)}
gssgssgnkdnldlagltsllsekikeflqekkmqsfyqqeletveslqslasrpvthst
gsdqvelkdsgtsgvaqrvfknalqllqekglvfqrdsgsdklyyvttkdkdlqsgpssg

SCOP Domain Coordinates for d1wj5a_:

Click to download the PDB-style file with coordinates for d1wj5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wj5a_: