![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.59: An Obfc1 domain [116801] (1 protein) helix-loop insertion in the HTH motif |
![]() | Protein OB fold-containing protein 1, Obfc1 [116802] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [116803] (1 PDB entry) |
![]() | Domain d1wj5a_: 1wj5 A: [114692] Structural genomics target |
PDB Entry: 1wj5 (more details)
SCOP Domain Sequences for d1wj5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj5a_ a.4.5.59 (A:) OB fold-containing protein 1, Obfc1 {Mouse (Mus musculus)} gssgssgnkdnldlagltsllsekikeflqekkmqsfyqqeletveslqslasrpvthst gsdqvelkdsgtsgvaqrvfknalqllqekglvfqrdsgsdklyyvttkdkdlqsgpssg
Timeline for d1wj5a_: