SCOPe 2.08: Domain d1wj5a1: 1wj5 A:8-114

Lineage for d1wj5a1 (1wj5 A:8-114)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.59: An Obfc1 domain [116801] (1 protein)
   helix-loop insertion in the HTH motif
   automatically mapped to Pfam PF09170

6. Protein OB fold-containing protein 1, Obfc1 [116802] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116803] (1 PDB entry)
   Uniprot Q8K2X3 198-304

8. Domain d1wj5a1: 1wj5 A:8-114 [114692]
   Other proteins in same PDB: d1wj5a2, d1wj5a3
   Structural genomics target

Details for d1wj5a1

PDB Entry: 1wj5

PDB Description: solution structure of the hypothetical domain of riken cdna 0610009h20

PDB Compounds: (A:) hypothetical protein (RIKEN cDNA 0610009H20)

SCOPe Domain Sequences for d1wj5a1:

Sequence; same for both SEQRES and ATOM records:

>d1wj5a1 a.4.5.59 (A:8-114) OB fold-containing protein 1, Obfc1 {Mouse (Mus musculus) [TaxId: 10090]}
nkdnldlagltsllsekikeflqekkmqsfyqqeletveslqslasrpvthstgsdqvel
kdsgtsgvaqrvfknalqllqekglvfqrdsgsdklyyvttkdkdlq

Timeline for d1wj5a1:

• d1wj5a1 first appeared in SCOP 1.71, called d1wj5a_
  
• d1wj5a1 appears in SCOPe 2.07