Lineage for d1wj5a1 (1wj5 A:8-114)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983450Family a.4.5.59: An Obfc1 domain [116801] (1 protein)
    helix-loop insertion in the HTH motif
    automatically mapped to Pfam PF09170
  6. 1983451Protein OB fold-containing protein 1, Obfc1 [116802] (1 species)
  7. 1983452Species Mouse (Mus musculus) [TaxId:10090] [116803] (1 PDB entry)
    Uniprot Q8K2X3 198-304
  8. 1983453Domain d1wj5a1: 1wj5 A:8-114 [114692]
    Other proteins in same PDB: d1wj5a2, d1wj5a3
    Structural genomics target

Details for d1wj5a1

PDB Entry: 1wj5 (more details)

PDB Description: Solution structure of the hypothetical domain of RIKEN cDNA 0610009H20
PDB Compounds: (A:) hypothetical protein (RIKEN cDNA 0610009H20)

SCOPe Domain Sequences for d1wj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj5a1 a.4.5.59 (A:8-114) OB fold-containing protein 1, Obfc1 {Mouse (Mus musculus) [TaxId: 10090]}
nkdnldlagltsllsekikeflqekkmqsfyqqeletveslqslasrpvthstgsdqvel
kdsgtsgvaqrvfknalqllqekglvfqrdsgsdklyyvttkdkdlq

SCOPe Domain Coordinates for d1wj5a1:

Click to download the PDB-style file with coordinates for d1wj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wj5a1: