Lineage for d1wj4a_ (1wj4 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638218Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 1638222Protein Hypothetical protein KIAA0794 [117818] (1 species)
  7. 1638223Species Human (Homo sapiens) [TaxId:9606] [117819] (1 PDB entry)
    Uniprot O94888 376-487
  8. 1638224Domain d1wj4a_: 1wj4 A: [114691]
    Structural genomics target

Details for d1wj4a_

PDB Entry: 1wj4 (more details)

PDB Description: solution structure of the ubx domain of kiaa0794 protein
PDB Compounds: (A:) KIAA0794 protein

SCOPe Domain Sequences for d1wj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtatnhqglpavdseilemppekadgvvegidvngpkaqlmlrypdgkreqitl
peqakllalvkhvqskgypnerfelltnfprrklshldyditlqeaglcpqetvfvqesg
pssg

SCOPe Domain Coordinates for d1wj4a_:

Click to download the PDB-style file with coordinates for d1wj4a_.
(The format of our PDB-style files is described here.)

Timeline for d1wj4a_: