SCOPe 2.03: Domain d1wj4a_: 1wj4 A:

Lineage for d1wj4a_ (1wj4 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.2: UBX domain [54250] (6 proteins)
   Pfam PF00789

6. Protein Hypothetical protein KIAA0794 [117818] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117819] (1 PDB entry)
   Uniprot O94888 376-487

8. Domain d1wj4a_: 1wj4 A: [114691]
   Structural genomics target

Details for d1wj4a_

PDB Entry: 1wj4

PDB Description: solution structure of the ubx domain of kiaa0794 protein

PDB Compounds: (A:) KIAA0794 protein

SCOPe Domain Sequences for d1wj4a_:

Sequence; same for both SEQRES and ATOM records:

>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtatnhqglpavdseilemppekadgvvegidvngpkaqlmlrypdgkreqitl
peqakllalvkhvqskgypnerfelltnfprrklshldyditlqeaglcpqetvfvqesg
pssg

Timeline for d1wj4a_:

• d1wj4a_ first appeared in SCOP 1.71
  
• d1wj4a_ appears in SCOPe 2.02
  
• d1wj4a_ appears in SCOPe 2.04
  
• d1wj4a_ appears in the current release, SCOPe 2.08, called d1wj4a1