SCOPe 2.07: Domain d1wj3a1: 1wj3 A:8-111

Lineage for d1wj3a1 (1wj3 A:8-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Contactin 3 (KIAA1496) [117055] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117056] (1 PDB entry)
   Uniprot Q9P232 893-996

8. Domain d1wj3a1: 1wj3 A:8-111 [114690]
   Other proteins in same PDB: d1wj3a2, d1wj3a3
   Structural genomics target

Details for d1wj3a1

PDB Entry: 1wj3

PDB Description: solution structure of the fourth fn3 domain of kiaa1496 protein

PDB Compounds: (A:) KIAA1496 protein

SCOPe Domain Sequences for d1wj3a1:

Sequence; same for both SEQRES and ATOM records:

>d1wj3a1 b.1.2.1 (A:8-111) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}
tvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrtssqnnvqv
lntnktsaelvlpikedyiievkattdggdgtsseqiriprits

Timeline for d1wj3a1:

• d1wj3a1 first appeared in SCOP 1.71, called d1wj3a_
  
• d1wj3a1 appears in SCOPe 2.06
  
• d1wj3a1 appears in the current release, SCOPe 2.08