Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Contactin 3 (KIAA1496) [117055] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117056] (1 PDB entry) Uniprot Q9P232 893-996 |
Domain d1wj3a_: 1wj3 A: [114690] Structural genomics target |
PDB Entry: 1wj3 (more details)
SCOPe Domain Sequences for d1wj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} gssgssgtvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrts sqnnvqvlntnktsaelvlpikedyiievkattdggdgtsseqiripritssgpssg
Timeline for d1wj3a_: