Lineage for d1wj3a_ (1wj3 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935758Protein Contactin 3 (KIAA1496) [117055] (1 species)
  7. 935759Species Human (Homo sapiens) [TaxId:9606] [117056] (1 PDB entry)
    Uniprot Q9P232 893-996
  8. 935760Domain d1wj3a_: 1wj3 A: [114690]
    Structural genomics target

Details for d1wj3a_

PDB Entry: 1wj3 (more details)

PDB Description: solution structure of the fourth fn3 domain of kiaa1496 protein
PDB Compounds: (A:) KIAA1496 protein

SCOPe Domain Sequences for d1wj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrts
sqnnvqvlntnktsaelvlpikedyiievkattdggdgtsseqiripritssgpssg

SCOPe Domain Coordinates for d1wj3a_:

Click to download the PDB-style file with coordinates for d1wj3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wj3a_: