Lineage for d1wj3a_ (1wj3 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550837Protein Contactin 3 (KIAA1496) [117055] (1 species)
  7. 550838Species Human (Homo sapiens) [TaxId:9606] [117056] (1 PDB entry)
  8. 550839Domain d1wj3a_: 1wj3 A: [114690]
    Structural genomics target

Details for d1wj3a_

PDB Entry: 1wj3 (more details)

PDB Description: Solution structure of the fourth fn3 domain of KIAA1496 protein

SCOP Domain Sequences for d1wj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens)}
gssgssgtvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrts
sqnnvqvlntnktsaelvlpikedyiievkattdggdgtsseqiripritssgpssg

SCOP Domain Coordinates for d1wj3a_:

Click to download the PDB-style file with coordinates for d1wj3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wj3a_: