Lineage for d1wj1a1 (1wj1 A:8-150)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412882Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2412924Protein Numb [50762] (3 species)
  7. 2412932Species Mouse (Mus musculus) [TaxId:10090] [117256] (1 PDB entry)
    Uniprot Q9QZS3 19-172
  8. 2412933Domain d1wj1a1: 1wj1 A:8-150 [114688]
    Other proteins in same PDB: d1wj1a2, d1wj1a3
    Structural genomics target

Details for d1wj1a1

PDB Entry: 1wj1 (more details)

PDB Description: solution structure of phosphotyrosine interaction domain of mouse numb protein
PDB Compounds: (A:) numb protein

SCOPe Domain Sequences for d1wj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj1a1 b.55.1.2 (A:8-150) Numb {Mouse (Mus musculus) [TaxId: 10090]}
asrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkkavkavlw
vsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmavkd
tgerlshavgcafaaclerkqkr

SCOPe Domain Coordinates for d1wj1a1:

Click to download the PDB-style file with coordinates for d1wj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1wj1a1: