SCOPe 2.06: Domain d1wj1a1: 1wj1 A:8-150

Lineage for d1wj1a1 (1wj1 A:8-150)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Numb [50762] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117256] (1 PDB entry)
   Uniprot Q9QZS3 19-172

8. Domain d1wj1a1: 1wj1 A:8-150 [114688]
   Other proteins in same PDB: d1wj1a2, d1wj1a3
   Structural genomics target

Details for d1wj1a1

PDB Entry: 1wj1

PDB Description: solution structure of phosphotyrosine interaction domain of mouse numb protein

PDB Compounds: (A:) numb protein

SCOPe Domain Sequences for d1wj1a1:

Sequence; same for both SEQRES and ATOM records:

>d1wj1a1 b.55.1.2 (A:8-150) Numb {Mouse (Mus musculus) [TaxId: 10090]}
asrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkkavkavlw
vsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmavkd
tgerlshavgcafaaclerkqkr

Timeline for d1wj1a1:

• d1wj1a1 first appeared in SCOP 1.71, called d1wj1a_
  
• d1wj1a1 was called d1wj1a_ in SCOPe 2.05
  
• d1wj1a1 appears in SCOPe 2.07
  
• d1wj1a1 appears in the current release, SCOPe 2.08