SCOPe 2.08: Domain d1wj0a_: 1wj0 A:

Lineage for d1wj0a_ (1wj0 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.72: SBT domain [103611] (1 superfamily)
   consist of two different zn-binding subdomains, each subdomain resembles a distorted glucocorticoid receptor-like fold

4. Superfamily g.72.1: SBT domain [103612] (1 family)
   automatically mapped to Pfam PF03110

5. Family g.72.1.1: SBT domain [103613] (3 proteins)
   Pfam PF03110

6. Protein Squamosa-promoter binding-like protein 12, DNA-binding domain [118281] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118282] (1 PDB entry)
   Uniprot Q9S7P5 124-181

8. Domain d1wj0a_: 1wj0 A: [114687]
   Structural genomics target
   complexed with zn

Details for d1wj0a_

PDB Entry: 1wj0

PDB Description: solution structure of the dna-binding domain of squamosa promoter binding protein-like 12 lacking the second zinc-binding site

PDB Compounds: (A:) squamosa promoter-binding protein-like 12

SCOPe Domain Sequences for d1wj0a_:

Sequence; same for both SEQRES and ATOM records:

>d1wj0a_ g.72.1.1 (A:) Squamosa-promoter binding-like protein 12, DNA-binding domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
aiccqvdncgadlskvkdyhrrhkvceihskattalvggimqrfcqqcsrfhvleefd

Timeline for d1wj0a_:

• d1wj0a_ first appeared in SCOP 1.71
  
• d1wj0a_ appears in SCOPe 2.07