Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.7: CUT domain [116891] (5 proteins) Pfam PF02376 |
Protein DNA-binding protein SATB2 [116894] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116895] (2 PDB entries) Uniprot Q9UPW6 350-437; the structure of a homedomain (615-672) is also known: 1WI3 |
Domain d1wiza1: 1wiz A:8-95 [114686] Other proteins in same PDB: d1wiza2, d1wiza3 Structural genomics target |
PDB Entry: 1wiz (more details)
SCOPe Domain Sequences for d1wiza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiza1 a.35.1.7 (A:8-95) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} kpeptnssvevspdiyqqvrdelkrasvsqavfarvafnrtqgllseilrkeedprtasq sllvnlramqnflnlpeverdriyqder
Timeline for d1wiza1: