Lineage for d1wiza_ (1wiz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733083Family a.35.1.7: CUT domain [116891] (5 proteins)
    Pfam PF02376
  6. 1733087Protein DNA-binding protein SATB2 [116894] (1 species)
  7. 1733088Species Human (Homo sapiens) [TaxId:9606] [116895] (2 PDB entries)
    Uniprot Q9UPW6 350-437; the structure of a homedomain (615-672) is also known: 1WI3
  8. 1733090Domain d1wiza_: 1wiz A: [114686]
    Structural genomics target

Details for d1wiza_

PDB Entry: 1wiz (more details)

PDB Description: Solution structure of the first CUT domain of KIAA1034 protein
PDB Compounds: (A:) DNA-binding protein SATB2

SCOPe Domain Sequences for d1wiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiza_ a.35.1.7 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkpeptnssvevspdiyqqvrdelkrasvsqavfarvafnrtqgllseilrkee
dprtasqsllvnlramqnflnlpeverdriyqdersgpssg

SCOPe Domain Coordinates for d1wiza_:

Click to download the PDB-style file with coordinates for d1wiza_.
(The format of our PDB-style files is described here.)

Timeline for d1wiza_: