SCOP 1.73: Domain d1wiza_: 1wiz A:

Lineage for d1wiza_ (1wiz A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.7: CUT domain [116891] (4 proteins)
   Pfam PF02376

6. Protein DNA-binding protein SATB2 [116894] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116895] (2 PDB entries)

8. Domain d1wiza_: 1wiz A: [114686]
   Structural genomics target

Details for d1wiza_

PDB Entry: 1wiz

PDB Description: solution structure of the first cut domain of kiaa1034 protein

PDB Compounds: (A:) DNA-binding protein SATB2

SCOP Domain Sequences for d1wiza_:

Sequence; same for both SEQRES and ATOM records:

>d1wiza_ a.35.1.7 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkpeptnssvevspdiyqqvrdelkrasvsqavfarvafnrtqgllseilrkee
dprtasqsllvnlramqnflnlpeverdriyqdersgpssg

Timeline for d1wiza_:

• d1wiza_ first appeared in SCOP 1.71
  
• d1wiza_ appears in SCOP 1.75
  
• d1wiza_ appears in the current release, SCOPe 2.08, called d1wiza1