Lineage for d1wiza_ (1wiz A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537429Family a.35.1.7: CUT domain [116891] (3 proteins)
    Pfam 02376
  6. 537430Protein DNA-binding protein SATB2 [116894] (1 species)
  7. 537431Species Human (Homo sapiens) [TaxId:9606] [116895] (1 PDB entry)
  8. 537432Domain d1wiza_: 1wiz A: [114686]
    Structural genomics target

Details for d1wiza_

PDB Entry: 1wiz (more details)

PDB Description: Solution structure of the first CUT domain of KIAA1034 protein

SCOP Domain Sequences for d1wiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiza_ a.35.1.7 (A:) DNA-binding protein SATB2 {Human (Homo sapiens)}
gssgssgkpeptnssvevspdiyqqvrdelkrasvsqavfarvafnrtqgllseilrkee
dprtasqsllvnlramqnflnlpeverdriyqdersgpssg

SCOP Domain Coordinates for d1wiza_:

Click to download the PDB-style file with coordinates for d1wiza_.
(The format of our PDB-style files is described here.)

Timeline for d1wiza_: