SCOPe 2.08: Domain d1wiza1: 1wiz A:8-95

Lineage for d1wiza1 (1wiz A:8-95)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein DNA-binding protein SATB2 [116894] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116895] (2 PDB entries)
   Uniprot Q9UPW6 350-437; the structure of a homedomain (615-672) is also known: 1WI3

8. Domain d1wiza1: 1wiz A:8-95 [114686]
   Other proteins in same PDB: d1wiza2, d1wiza3
   Structural genomics target

Details for d1wiza1

PDB Entry: 1wiz

PDB Description: solution structure of the first cut domain of kiaa1034 protein

PDB Compounds: (A:) DNA-binding protein SATB2

SCOPe Domain Sequences for d1wiza1:

Sequence; same for both SEQRES and ATOM records:

>d1wiza1 a.35.1.7 (A:8-95) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
kpeptnssvevspdiyqqvrdelkrasvsqavfarvafnrtqgllseilrkeedprtasq
sllvnlramqnflnlpeverdriyqder

Timeline for d1wiza1:

• d1wiza1 first appeared in SCOP 1.71, called d1wiza_
  
• d1wiza1 appears in SCOPe 2.07