SCOP 1.73: Domain d1wixa_: 1wix A:

Lineage for d1wixa_ (1wix A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.3: Hook domain [116907] (1 family)

5. Family a.40.3.1: Hook domain [116908] (1 protein)
   N-terminal part of Pfam PF05622

6. Protein Hook homolog 1, Hook1 [116909] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116910] (1 PDB entry)

8. Domain d1wixa_: 1wix A: [114683]
   Structural genomics target

Details for d1wixa_

PDB Entry: 1wix

PDB Description: the solution structure of rsgi ruh-026, conserved domain of hook1 protein from mouse

PDB Compounds: (A:) Hook homolog 1

SCOP Domain Sequences for d1wixa_:

Sequence; same for both SEQRES and ATOM records:

>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssglplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrik
ddvgdnwrikasnlkkvlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqli
lgcavncekkqehiknimtleesvqhvvmtaiqelmsksgpssg

Timeline for d1wixa_:

• d1wixa_ first appeared in SCOP 1.71
  
• d1wixa_ appears in SCOP 1.75
  
• d1wixa_ appears in the current release, SCOPe 2.08, called d1wixa1