Lineage for d1wixa_ (1wix A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641474Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 641542Superfamily a.40.3: Hook domain [116907] (1 family) (S)
  5. 641543Family a.40.3.1: Hook domain [116908] (1 protein)
    N-terminal part of Pfam PF05622
  6. 641544Protein Hook homolog 1, Hook1 [116909] (1 species)
  7. 641545Species Mouse (Mus musculus) [TaxId:10090] [116910] (1 PDB entry)
  8. 641546Domain d1wixa_: 1wix A: [114683]
    Structural genomics target

Details for d1wixa_

PDB Entry: 1wix (more details)

PDB Description: the solution structure of rsgi ruh-026, conserved domain of hook1 protein from mouse
PDB Compounds: (A:) Hook homolog 1

SCOP Domain Sequences for d1wixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssglplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrik
ddvgdnwrikasnlkkvlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqli
lgcavncekkqehiknimtleesvqhvvmtaiqelmsksgpssg

SCOP Domain Coordinates for d1wixa_:

Click to download the PDB-style file with coordinates for d1wixa_.
(The format of our PDB-style files is described here.)

Timeline for d1wixa_: