Lineage for d1wixa1 (1wix A:8-158)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995978Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1996125Superfamily a.40.3: Hook domain [116907] (1 family) (S)
    automatically mapped to Pfam PF05622
  5. 1996126Family a.40.3.1: Hook domain [116908] (1 protein)
    N-terminal part of Pfam PF05622
  6. 1996127Protein Hook homolog 1, Hook1 [116909] (1 species)
  7. 1996128Species Mouse (Mus musculus) [TaxId:10090] [116910] (1 PDB entry)
    Uniprot Q8BIL5 12-162
  8. 1996129Domain d1wixa1: 1wix A:8-158 [114683]
    Other proteins in same PDB: d1wixa2, d1wixa3
    Structural genomics target

Details for d1wixa1

PDB Entry: 1wix (more details)

PDB Description: The solution structure of RSGI RUH-026, conserved domain of HOOK1 protein from mouse
PDB Compounds: (A:) Hook homolog 1

SCOPe Domain Sequences for d1wixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wixa1 a.40.3.1 (A:8-158) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]}
lplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrikddvgdnw
rikasnlkkvlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqlilgcavnc
ekkqehiknimtleesvqhvvmtaiqelmsk

SCOPe Domain Coordinates for d1wixa1:

Click to download the PDB-style file with coordinates for d1wixa1.
(The format of our PDB-style files is described here.)

Timeline for d1wixa1: