SCOPe 2.08: Domain d1wixa1: 1wix A:8-158

Lineage for d1wixa1 (1wix A:8-158)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.3: Hook domain [116907] (1 family)
   automatically mapped to Pfam PF05622

5. Family a.40.3.1: Hook domain [116908] (1 protein)
   N-terminal part of Pfam PF05622

6. Protein Hook homolog 1, Hook1 [116909] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116910] (1 PDB entry)
   Uniprot Q8BIL5 12-162

8. Domain d1wixa1: 1wix A:8-158 [114683]
   Other proteins in same PDB: d1wixa2, d1wixa3
   Structural genomics target

Details for d1wixa1

PDB Entry: 1wix

PDB Description: the solution structure of rsgi ruh-026, conserved domain of hook1 protein from mouse

PDB Compounds: (A:) Hook homolog 1

SCOPe Domain Sequences for d1wixa1:

Sequence; same for both SEQRES and ATOM records:

>d1wixa1 a.40.3.1 (A:8-158) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]}
lplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrikddvgdnw
rikasnlkkvlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqlilgcavnc
ekkqehiknimtleesvqhvvmtaiqelmsk

Timeline for d1wixa1:

• d1wixa1 first appeared in SCOP 1.71, called d1wixa_
  
• d1wixa1 appears in SCOPe 2.07