Lineage for d1wiwb_ (1wiw B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140245Family c.80.1.1: double-SIS domain [53698] (5 protein domains)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2140270Protein Glucose-6-phosphate isomerase-like protein TTHA1346 [117730] (1 species)
  7. 2140271Species Thermus thermophilus [TaxId:274] [117731] (1 PDB entry)
    Uniprot Q5SIM3
  8. 2140273Domain d1wiwb_: 1wiw B: [114682]
    Structural genomics target

Details for d1wiwb_

PDB Entry: 1wiw (more details), 2 Å

PDB Description: Crystal structure of a glucose-6-phosphate isomerase like protein from thermus thermophilus HB8
PDB Compounds: (B:) Glucose-6-phosphate isomerase like protein

SCOPe Domain Sequences for d1wiwb_:

Sequence, based on SEQRES records: (download)

>d1wiwb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase-like protein TTHA1346 {Thermus thermophilus [TaxId: 274]}
mrdldreetylvdrtglalelrdlvgtgpvpgeaypgphaalgygegqfaallsglpdwg
eegtlflleggydlgeaagmallaetgrarvvrvgfrpgvevhippsplapyrylrflll
atgreevlrsvdealleerrrlgpevpveenpakflaytllerlplfysplfrplegavq
tlfarvakslsltpppsalefflvglearheqgdplaavllgpgeeaalakeilesrvda
laevpatganrlaqvmalwyrmawtayylallygvdpgdhgllerlrevt

Sequence, based on observed residues (ATOM records): (download)

>d1wiwb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase-like protein TTHA1346 {Thermus thermophilus [TaxId: 274]}
mrdldreetylvdrtglalelrdlvgtgpvpgeaypgphaalgygegqfaallsglpdwg
eegtlflleggydlgeaagmallagrarvvrvgfrpgvevhippsplapyrylrflllat
greevlrsvdealleerrrlgpevpveenpakflaytllerlplfysplfrplegavqtl
farvakslsltpppsalefflvglegdplaavllgpgeeaalakeilesrvdalaevpat
ganrlaqvmalwyrmawtayylallygvdpgdhgllerlrevt

SCOPe Domain Coordinates for d1wiwb_:

Click to download the PDB-style file with coordinates for d1wiwb_.
(The format of our PDB-style files is described here.)

Timeline for d1wiwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wiwa_