Lineage for d1wiva1 (1wiv A:8-67)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984830Protein Ubiquitin isopeptidase T [116826] (1 species)
  7. 1984831Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116827] (2 PDB entries)
    Uniprot Q9LJT6 594-665; Q8L6Y1 651-710
  8. 1984833Domain d1wiva1: 1wiv A:8-67 [114680]
    Other proteins in same PDB: d1wiva2, d1wiva3
    Structural genomics target

Details for d1wiva1

PDB Entry: 1wiv (more details)

PDB Description: solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
PDB Compounds: (A:) ubiquitin-specific protease 14

SCOPe Domain Sequences for d1wiva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiva1 a.5.2.1 (A:8-67) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
llshmddpdidapishqtsdidqssvdtllsfgfaedvarkalkasggdiekatdwvfnn

SCOPe Domain Coordinates for d1wiva1:

Click to download the PDB-style file with coordinates for d1wiva1.
(The format of our PDB-style files is described here.)

Timeline for d1wiva1: