SCOPe 2.08: Domain d1wiva1: 1wiv A:8-67

Lineage for d1wiva1 (1wiv A:8-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin isopeptidase T [116826] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116827] (2 PDB entries)
   Uniprot Q9LJT6 594-665; Q8L6Y1 651-710

8. Domain d1wiva1: 1wiv A:8-67 [114680]
   Other proteins in same PDB: d1wiva2, d1wiva3
   Structural genomics target

Details for d1wiva1

PDB Entry: 1wiv

PDB Description: solution structure of rsgi ruh-023, a uba domain from arabidopsis cdna

PDB Compounds: (A:) ubiquitin-specific protease 14

SCOPe Domain Sequences for d1wiva1:

Sequence; same for both SEQRES and ATOM records:

>d1wiva1 a.5.2.1 (A:8-67) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
llshmddpdidapishqtsdidqssvdtllsfgfaedvarkalkasggdiekatdwvfnn

Timeline for d1wiva1:

• d1wiva1 first appeared in SCOP 1.71, called d1wiva_
  
• d1wiva1 appears in SCOPe 2.07