Lineage for d1wina1 (1win A:8-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945956Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2945996Superfamily d.43.2: Band 7/SPFH domain [117892] (1 family) (S)
    beta(2)-alpha(3)-beta
    automatically mapped to Pfam PF01145
  5. 2945997Family d.43.2.1: Band 7/SPFH domain [117893] (1 protein)
    Pfam PF01145
  6. 2945998Protein Flotillin-2 [117894] (1 species)
  7. 2945999Species Mouse (Mus musculus) [TaxId:10090] [117895] (1 PDB entry)
    Uniprot Q60634 1-123
  8. 2946000Domain d1wina1: 1win A:8-137 [114678]
    Other proteins in same PDB: d1wina2, d1wina3
    Structural genomics target

Details for d1wina1

PDB Entry: 1win (more details)

PDB Description: solution structure of the band 7 domain of the mouse flotillin 2 protein
PDB Compounds: (A:) Flotillin 2

SCOPe Domain Sequences for d1wina1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wina1 d.43.2.1 (A:8-137) Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]}
qrisleimtlqprcedvetaegvaltvtgvaqvkimtekellavaceqflgknvqdiknv
vlqtleghlrsilgtltveqiyqdrdqfaklvrevaapdvgrmgieilsftikdvydkvd
ylsslgktqt

SCOPe Domain Coordinates for d1wina1:

Click to download the PDB-style file with coordinates for d1wina1.
(The format of our PDB-style files is described here.)

Timeline for d1wina1: