SCOPe 2.07: Domain d1wima1: 1wim A:8-88

Lineage for d1wima1 (1wim A:8-88)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein UbcM4-interacting protein 4 (KIAA0161) [118296] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118297] (1 PDB entry)

8. Domain d1wima1: 1wim A:8-88 [114677]
   Other proteins in same PDB: d1wima2, d1wima3
   Structural genomics target; contains extra C-terminal IBR region
   complexed with zn

Details for d1wima1

PDB Entry: 1wim

PDB Description: solution structure of the ring finger domain of the human ubcm4- interacting protein 4

PDB Compounds: (A:) KIAA0161 protein

SCOPe Domain Sequences for d1wima1:

Sequence; same for both SEQRES and ATOM records:

>d1wima1 g.44.1.1 (A:8-88) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}
cklclgeypveqmttiaqcqcifctlclkqyvellikegletaiscpdaacpkqghlqen
eiecmvaaeimqrykklqfer

Timeline for d1wima1:

• d1wima1 first appeared in SCOP 1.71, called d1wima_
  
• d1wima1 appears in SCOPe 2.06
  
• d1wima1 appears in the current release, SCOPe 2.08