![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.3: variant PHD-like domain [118346] (1 protein) |
![]() | Protein Hypothetical protein KIAA1045 [118347] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118348] (1 PDB entry) Uniprot Q9UPV7 123-198 |
![]() | Domain d1wila1: 1wil A:8-83 [114676] Other proteins in same PDB: d1wila2, d1wila3 Structural genomics target complexed with zn |
PDB Entry: 1wil (more details)
SCOPe Domain Sequences for d1wila1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wila1 g.50.1.3 (A:8-83) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} prepvvndemcdvcevwtaeslfpcrvctrvfhdgclrrmgyiqgdsaaevtemahtetg wschycdninllltee
Timeline for d1wila1: