SCOPe 2.08: Domain d1wila1: 1wil A:8-83

Lineage for d1wila1 (1wil A:8-83)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.3: variant PHD-like domain [118346] (1 protein)

6. Protein Hypothetical protein KIAA1045 [118347] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118348] (1 PDB entry)
   Uniprot Q9UPV7 123-198

8. Domain d1wila1: 1wil A:8-83 [114676]
   Other proteins in same PDB: d1wila2, d1wila3
   Structural genomics target
   complexed with zn

Details for d1wila1

PDB Entry: 1wil

PDB Description: solution structure of the ring finger domain of the human kiaa1045 protein

PDB Compounds: (A:) KIAA1045 protein

SCOPe Domain Sequences for d1wila1:

Sequence; same for both SEQRES and ATOM records:

>d1wila1 g.50.1.3 (A:8-83) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]}
prepvvndemcdvcevwtaeslfpcrvctrvfhdgclrrmgyiqgdsaaevtemahtetg
wschycdninllltee

Timeline for d1wila1:

• d1wila1 first appeared in SCOP 1.71, called d1wila_
  
• d1wila1 appears in SCOPe 2.07