Class a: All alpha proteins [46456] (290 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.5: DNA-binding domain of EIN3-like [116768] (1 family) decorated with additional structures automatically mapped to Pfam PF04873 |
Family a.140.5.1: DNA-binding domain of EIN3-like [116769] (2 proteins) middle part of Pfam PF04873 |
Protein Ethylene insensitive 3 (EIN3)-like protein 3, EIL3 [116770] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116771] (1 PDB entry) Uniprot O23116 162-288 |
Domain d1wija_: 1wij A: [114674] Structural genomics target |
PDB Entry: 1wij (more details)
SCOPe Domain Sequences for d1wija_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wija_ a.140.5.1 (A:) Ethylene insensitive 3 (EIN3)-like protein 3, EIL3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sqfvlqdlqdatlgsllsslmqhcdppqrkyplekgtpppwwptgneewwvklglpksqs ppyrkphdlkkmwkvgvltavinhmlpdiakikrhvrqskclqdkmtakesaiwlavlnq eesliqq
Timeline for d1wija_: