Lineage for d1wija_ (1wij A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012958Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2013061Superfamily a.140.5: DNA-binding domain of EIN3-like [116768] (1 family) (S)
    decorated with additional structures
    automatically mapped to Pfam PF04873
  5. 2013062Family a.140.5.1: DNA-binding domain of EIN3-like [116769] (2 protein domains)
    middle part of Pfam PF04873
  6. 2013063Protein Ethylene insensitive 3 (EIN3)-like protein 3, EIL3 [116770] (1 species)
  7. 2013064Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116771] (1 PDB entry)
    Uniprot O23116 162-288
  8. 2013065Domain d1wija_: 1wij A: [114674]
    Structural genomics target

Details for d1wija_

PDB Entry: 1wij (more details)

PDB Description: Solution Structure of the DNA-Binding Domain of Ethylene-Insensitive3-Like3
PDB Compounds: (A:) ETHYLENE-INSENSITIVE3-like 3 protein

SCOPe Domain Sequences for d1wija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wija_ a.140.5.1 (A:) Ethylene insensitive 3 (EIN3)-like protein 3, EIL3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqfvlqdlqdatlgsllsslmqhcdppqrkyplekgtpppwwptgneewwvklglpksqs
ppyrkphdlkkmwkvgvltavinhmlpdiakikrhvrqskclqdkmtakesaiwlavlnq
eesliqq

SCOPe Domain Coordinates for d1wija_:

Click to download the PDB-style file with coordinates for d1wija_.
(The format of our PDB-style files is described here.)

Timeline for d1wija_: