Lineage for d1wiha_ (1wih A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605436Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 605468Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 605469Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 605470Protein Ribosome recycling factor, RRF [55196] (6 species)
  7. 605476Species Mouse (Mus musculus), mitochondrial [TaxId:10090] [118014] (1 PDB entry)
  8. 605477Domain d1wiha_: 1wih A: [114672]
    Structural genomics target; core domain only

Details for d1wiha_

PDB Entry: 1wih (more details)

PDB Description: Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from mouse cDNA

SCOP Domain Sequences for d1wiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiha_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial}
gssgssgldhitvvtadgkvalnqigqismkspqvilvnmasfpectaaaikairesgmn
lnpevegtlirvpipkvtsgpssg

SCOP Domain Coordinates for d1wiha_:

Click to download the PDB-style file with coordinates for d1wiha_.
(The format of our PDB-style files is described here.)

Timeline for d1wiha_: