![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
![]() | Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins) |
![]() | Protein Ribosome recycling factor, RRF [55196] (7 species) |
![]() | Species Mouse (Mus musculus), mitochondrial [TaxId:10090] [118014] (1 PDB entry) Uniprot Q9D6S7 116-186 |
![]() | Domain d1wiha1: 1wih A:8-78 [114672] Other proteins in same PDB: d1wiha2, d1wiha3 Structural genomics target; core domain only fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1wih (more details)
SCOPe Domain Sequences for d1wiha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiha1 d.67.3.1 (A:8-78) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} ldhitvvtadgkvalnqigqismkspqvilvnmasfpectaaaikairesgmnlnpeveg tlirvpipkvt
Timeline for d1wiha1: