Lineage for d1wiha1 (1wih A:8-78)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2957018Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2957019Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 2957020Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 2957029Species Mouse (Mus musculus), mitochondrial [TaxId:10090] [118014] (1 PDB entry)
    Uniprot Q9D6S7 116-186
  8. 2957030Domain d1wiha1: 1wih A:8-78 [114672]
    Other proteins in same PDB: d1wiha2, d1wiha3
    Structural genomics target; core domain only
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1wiha1

PDB Entry: 1wih (more details)

PDB Description: solution structure of rsgi ruh-021, a domain ii of ribosome recycling factor from mouse cdna
PDB Compounds: (A:) mitochondrial ribosome recycling factor

SCOPe Domain Sequences for d1wiha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiha1 d.67.3.1 (A:8-78) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]}
ldhitvvtadgkvalnqigqismkspqvilvnmasfpectaaaikairesgmnlnpeveg
tlirvpipkvt

SCOPe Domain Coordinates for d1wiha1:

Click to download the PDB-style file with coordinates for d1wiha1.
(The format of our PDB-style files is described here.)

Timeline for d1wiha1: